PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G021300.1
Common NameB456_003G021300, LOC105787594
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 364aa    MW: 41435.8 Da    PI: 7.7647
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G021300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81.1e-32238293156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFvea+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Gorai.003G021300.1 238 KQRRCWSPELHKRFVEALQKLGGSKVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 293
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.212235295IPR017930Myb domain
SuperFamilySSF466891.4E-18236296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28237296IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-27238293IPR006447Myb domain, plants
PfamPF002495.5E-9240291IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MFEKKREREK KRIMELNMDV DLVYVPETVS EFLKQASKIK NGFQRLCKIS DYVRRLEDEM  60
KKIDAFKREL PICMLLLKDV IKRLKEEEMM CKELGDGSVT IDEGNGKVNK ENDGGAGNKR  120
NWLSTVQLWN SDSEKVDQNK KPNKVPGLKL GSEEEEEEEQ DMFEDPIEFF NNRRFKGQMD  180
KENLELSLMT PSFDLGSSSP SHNPILKIND NCKTGFGSDQ NQTKFQTKHQ QDMQNCKKQR  240
RCWSPELHKR FVEALQKLGG SKVATPKQIR ELMQVDGLTN DEVKSHLQKY RLHFRKVASD  300
SSAQNQCNEK MKANISESDS PQGPLRAGGW AKGLSSGGSV VEGEDDEKSD GRSWRSGGTK  360
TGD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8377000.0JQ837700.1 Gossypium hirsutum cultivar ZM3 MYB mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469518.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A0D2RFB90.0A0A0D2RFB9_G
STRINGPOPTR_0007s11470.12e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-55G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]